PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.8NR3H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 260aa    MW: 29859.7 Da    PI: 7.6551
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.8NR3HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.87.4e-5271311128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelv++yL+kk++++++ +  +ike+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ +   +
  Araip.8NR3H   7 LPPGFRFHPTDEELVNHYLCKKCASQSIAV-PIIKEIDLYKFDPWHLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGK--PK 101
                  79*************************999.88***************7666789*************************************98..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +  +kk Lvfy g+apkg+kt+W+mheyrl
  Araip.8NR3H 102 ALAIKKALVFYAGKAPKGVKTNWIMHEYRL 131
                  89**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-614158IPR003441NAC domain
PROSITE profilePS5100559.1537158IPR003441NAC domain
PfamPF023653.0E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008361Biological Processregulation of cell size
GO:0009416Biological Processresponse to light stimulus
GO:0009611Biological Processresponse to wounding
GO:0009620Biological Processresponse to fungus
GO:0009744Biological Processresponse to sucrose
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0043424Molecular Functionprotein histidine kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MKSELELPPG FRFHPTDEEL VNHYLCKKCA SQSIAVPIIK EIDLYKFDPW HLPEMALYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGSGYWKA TGADKPIGKP KALAIKKALV FYAGKAPKGV  120
KTNWIMHEYR LANVDRSAGN KKNNLRLDDW VLCRIYNKKG KIEKYNHLGA ADHKSASSEE  180
ENERKPEVKE RLHMDTSSDS VVSADVTWES REVQSEPKWN DLLDQVFDFQ LGSFVDFSSA  240
GDDPFAPQLS PWHQDTFITF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-83216410174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8538260.0EU853826.1 Arachis hypogaea NAC-like transcription factor (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016189707.10.0PREDICTED: protein ATAF2
SwissprotQ9C5981e-115NAC81_ARATH; Protein ATAF2
TrEMBLB5AK520.0B5AK52_ARAHY; NAC-like transcription factor
STRINGGLYMA05G32850.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-110NAC family protein